PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03021.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 467aa    MW: 53001.7 Da    PI: 10.2539
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03021.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.3e-19214261148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT++Ed+ll+++v+q+G g+W+++a+  g++R++k+c++rw +yl
  Zmw_sc03021.1.g00030.1.am.mk 214 KGPWTAQEDKLLLEYVRQHGEGRWNSVAKLTGLRRSGKSCRLRWVNYL 261
                                   79********************************************97 PP

2Myb_DNA-binding507e-16267311147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Zmw_sc03021.1.g00030.1.am.mk 267 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 311
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.825209261IPR017930Myb domain
SuperFamilySSF466896.36E-30212308IPR009057Homeodomain-like
SMARTSM007176.0E-17213263IPR001005SANT/Myb domain
PfamPF002492.7E-18214261IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-24215268IPR009057Homeodomain-like
CDDcd001674.50E-12216261No hitNo description
PROSITE profilePS5129424.933262316IPR017930Myb domain
SMARTSM007174.5E-15266314IPR001005SANT/Myb domain
PfamPF002491.2E-13267311IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-23269314IPR009057Homeodomain-like
CDDcd001671.69E-9271312No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
LAEPYRRGRR GDHVARAERP WGRGQGDVDA QRWVHAPETG RPPGGFSPMA TAAAIRMYRS  60
SEQRLSAANR VARFFFFLTV EATLMSAAAA SPGIDRATAF FYRLGEHFTA TPKSQVLSYI  120
RRWRPRFRQK VLRVQWQWGA PDSDVASTRA NIYAGSSSLR CRIASIQFTR SFTEDRGRQR  180
GSRRLISSIV DRQKKRLEME GRFGWGREEG GWRKGPWTAQ EDKLLLEYVR QHGEGRWNSV  240
AKLTGLRRSG KSCRLRWVNY LRPDLKRGKI TPQEESVILE LHALWGNRWS TIARSLPGRT  300
DNEIKNYWRT HFKKGKPSKN IERARARFLK QRCEMQSQLL LQGQEPPPPP QQLEEPGHDD  360
AATRKPAPAA CLAQQNEDLK MMMMDMDDLL YQLCPMSSCS SSYHLHGGSG SASAASEGSS  420
EEQLHGGDTW GWGSLWNLEG VVDDTDGCAC GWDSSFPWLQ DQGLAFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-252143147106B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190195DRQKKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454181.11e-130hypothetical protein SORBIDRAFT_04g026210
TrEMBLC5XXQ51e-130C5XXQ5_SORBI; Putative uncharacterized protein Sb04g026210
STRINGSb04g026210.11e-130(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584